Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADN0
Confidence12.17%DateThu Jan 5 11:21:24 GMT 2012
Rank94Aligned Residues24
% Identity25%Templatec3mtvA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:papain-like cysteine protease; PDBTitle: the crystal structure of the prrsv nonstructural protein nsp1
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   284.....290.........300.........310.........320....
Predicted Secondary structure 

























Query SS confidence 








































Query Sequence  RLVEKQLLTYRLHGESWREKVIERPVVHKDYDEQPRGPFIV
Query Conservation 
  
 


 
   
                     





Alig confidence 












.................










Template Conservation 








 


.................

    
  

Template Sequence  KYLQRRLQVNGLR. . . . . . . . . . . . . . . . . AVTDTHGPIVI
Template Known Secondary structure  TTT.................
TT
S
Template Predicted Secondary structure 

.................




Template SS confidence 








































   124.....130...... ...140.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions