Return to main results Retrieve Phyre Job Id

Job DescriptionQ46864
Confidence44.77%DateThu Jan 5 12:35:21 GMT 2012
Rank356Aligned Residues27
% Identity26%Templatec3cc4Z_
PDB info PDB header:ribosomeChain: Z: PDB Molecule:50s ribosomal protein l37ae; PDBTitle: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40....
Predicted Secondary structure 





















Query SS confidence 










































Query Sequence  KCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESI
Query Conservation   

 

               

    
       
  


  
Alig confidence 






................



















Template Conservation   

 


................  


   


 
 


   
Template Sequence  ACPNCGE. . . . . . . . . . . . . . . . DRVDRQGTGIWQCSYCDYKF
Template Known Secondary structure 
SSS

................
SSSTTT

Template Predicted Secondary structure 






................





Template SS confidence 










































   62...... .70.........80........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions