Return to main results Retrieve Phyre Job Id

Job DescriptionQ46864
Confidence37.72%DateThu Jan 5 12:35:21 GMT 2012
Rank412Aligned Residues31
% Identity26%Templatec2xzm6_
PDB info PDB header:ribosomeChain: 6: PDB Molecule:rps27e; PDBTitle: crystal structure of the eukaryotic 40s ribosomal2 subunit in complex with initiation factor 1. this file3 contains the 40s subunit and initiation factor for4 molecule 1
Resolution3.93 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.......
Predicted Secondary structure 























Query SS confidence 













































Query Sequence  KCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNK
Query Conservation   

 

               

    
       
  


     
Alig confidence 






.........












......










Template Conservation 

  
  .........   




 
 
 ......
  

  
  
Template Sequence  KCAQCQN. . . . . . . . . IQMIFSNAQSTII. . . . . . CEKCSAILCKP
Template Known Secondary structure 
SSS

.........TT
SS
......
SSS

Template Predicted Secondary structure 





.........



......




Template SS confidence 













































   34.....40 .........50... ......60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions