Return to main results Retrieve Phyre Job Id

Job DescriptionQ46864
Confidence61.36%DateThu Jan 5 12:35:21 GMT 2012
Rank267Aligned Residues25
% Identity28%Templatec2f9iD_
PDB info PDB header:transferaseChain: D: PDB Molecule:acetyl-coenzyme a carboxylase carboxyl PDBTitle: crystal structure of the carboxyltransferase subunit of acc2 from staphylococcus aureus
Resolution1.98 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.
Predicted Secondary structure 





















Query SS confidence 







































Query Sequence  KCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCE
Query Conservation   

 

               

    
       
  

Alig confidence 






..........








.....








Template Conservation 


 
  ..........    
 
  .....
  


 
 
Template Sequence  KCPKCKK. . . . . . . . . . IMYTKELAE. . . . . NLNVCFNCD
Template Known Secondary structure 
TTT

...............TTTB
TTT
Template Predicted Secondary structure 





...............






Template SS confidence 







































   32...... .40....... ..50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions