Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC73
Confidence16.78%DateThu Jan 5 11:17:27 GMT 2012
Rank24Aligned Residues43
% Identity16%Templatec3kgzA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:cupin 2 conserved barrel domain protein; PDBTitle: crystal structure of a cupin 2 conserved barrel domain protein from2 rhodopseudomonas palustris
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5960.........70.........80.........90.........100.........110.........120.....
Predicted Secondary structure 























Query SS confidence 


































































Query Sequence  FTGHRRYFEVHYYLQGQQKIEYAPKETLQVVEYYRDETDREYLKGCGETVEVHEGQIVICDIHEAYR
Query Conservation   
 

 




  
 
 
 
       
     
    
  
       
 
  
 
 



 
 
 
Alig confidence 



.
















.......................





















Template Conservation   
 
.   
   

 
 
    ....................... 
    
  

 
 

    
 
Template Sequence  LERH. AHVHAVMIHRGHGQCLV. . . . . . . . . . . . . . . . . . . . . . . GETISDVAQGDLVFIPPMTWHQ
Template Known Secondary structure 
BB
.SS
.......................TTTT

TT

Template Predicted Secondary structure 



.





.......................









Template SS confidence 


































































   75... .80.........90..... ....100.........110.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions