Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC73
Confidence2.34%DateThu Jan 5 11:17:27 GMT 2012
Rank87Aligned Residues35
% Identity20%Templatec3bu7A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:gentisate 1,2-dioxygenase; PDBTitle: crystal structure and biochemical characterization of gdosp,2 a gentisate 1,2-dioxygenase from silicibacter pomeroyi
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100.........110.........120.....
Predicted Secondary structure 



















Query SS confidence 

























































Query Sequence  VHYYLQGQQKIEYAPKETLQVVEYYRDETDREYLKGCGETVEVHEGQIVICDIHEAYR
Query Conservation 

  
 
 
 
       
     
    
  
       
 
  
 
 



 
 
 
Alig confidence 












.......................





















Template Conservation 
  

 
 
   
....................... 
    
  

 
 

    
 
Template Sequence  IYNVAKGQGYSIV. . . . . . . . . . . . . . . . . . . . . . . GGKRFDWSEHDIFCVPAWTWHE
Template Known Secondary structure 

.......................TT
TT

TT

Template Predicted Secondary structure 

.......................










Template SS confidence 

























































   297..300......... 310.........320.........330.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions