Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC73
Confidence32.77%DateThu Jan 5 11:17:27 GMT 2012
Rank10Aligned Residues35
% Identity20%Templatec2opkC_
PDB info PDB header:isomeraseChain: C: PDB Molecule:hypothetical protein; PDBTitle: crystal structure of a putative mannose-6-phosphate isomerase2 (reut_a1446) from ralstonia eutropha jmp134 at 2.10 a resolution
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   70.........80.........90.........100.........110.........120.....
Predicted Secondary structure 



















Query SS confidence 























































Query Sequence  YYLQGQQKIEYAPKETLQVVEYYRDETDREYLKGCGETVEVHEGQIVICDIHEAYR
Query Conservation    
 
 
 
       
     
    
  
       
 
  
 
 



 
 
 
Alig confidence 










.....................























Template Conservation   

 
 
 
  .....................
       
  

 
 



  

Template Sequence  XVVSGSAGIEC. . . . . . . . . . . . . . . . . . . . . EGDTAPRVXRPGDWLHVPAHCRHR
Template Known Secondary structure  S
.....................TT
SS

TT

TT

Template Predicted Secondary structure 
.....................












Template SS confidence 























































   57..60....... ..70.........80.........90.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions