Return to main results Retrieve Phyre Job Id

Job DescriptionP71298
Confidence4.34%DateThu Jan 5 12:12:44 GMT 2012
Rank99Aligned Residues34
% Identity21%Templated3c7bb2
SCOP infoFerredoxin-like Nitrite/Sulfite reductase N-terminal domain-like DsrA/DsrB N-terminal-domain-like
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60..... ....70.........80.........90.........100..
Predicted Secondary structure 

.












Query SS confidence 







.




































Query Sequence  TTLACRAT. SGAKAFVFQSVYAGKTLRMTIGNINDWKIDDARAEAR
Query Conservation   

 


 . 
 
      
  

  
  

  
  

  

  
 
Alig confidence 







.








.........



..












Template Conservation       
    
    


.........
  
..  






 


Template Sequence  PGVIKRVAESGDVIYVVR. . . . . . . . . FGTP. . RLLSIYTVRELCD
Template Known Secondary structure  TTTTS
.........


..SS

Template Predicted Secondary structure 






.........


..



Template SS confidence 













































   38.40.........50..... .... 60.........70..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions