Return to main results Retrieve Phyre Job Id

Job DescriptionP71298
Confidence6.40%DateThu Jan 5 12:12:44 GMT 2012
Rank73Aligned Residues22
% Identity27%Templated2izva1
SCOP infoSOCS box-like SOCS box-like SOCS box-like
Resolution2.55

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40....
Predicted Secondary structure 
















Query SS confidence 































Query Sequence  HYCKTAILNWSRKMALSRQKFTFERLRRFTLP
Query Conservation                 
    

   
  
   
Alig confidence 












..........








Template Conservation 



  

     ..........
 
  



Template Sequence  HICRTVICNCTTY. . . . . . . . . . DGIDALPIP
Template Known Secondary structure  S
..........TSSS
Template Predicted Secondary structure 

..........



Template SS confidence 































   391........400... ......410..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions