Return to main results Retrieve Phyre Job Id

Job DescriptionP71298
Confidence4.40%DateThu Jan 5 12:12:44 GMT 2012
Rank98Aligned Residues34
% Identity21%Templatec3gpkA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:ppic-type peptidyl-prolyl cis-trans isomerase; PDBTitle: crystal structure of ppic-type peptidyl-prolyl cis-trans isomerase2 domain at 1.55a resolution.
Resolution1.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   88.90.........100.........110.........120.........130.........140......
Predicted Secondary structure 













Query SS confidence 


























































Query Sequence  NINDWKIDDARAEARRLQTLIDTGIDPRIAKAVKIAEAESLQAESRKTKVTFSVAWEDY
Query Conservation    
  

  

  
      
  
 

   
                   
  
    
Alig confidence 

























.........................







Template Conservation           
   
  
   
  
  .........................
  

   
Template Sequence  AATEENKPQVFANAEKIVEQLKQGGS. . . . . . . . . . . . . . . . . . . . . . . . . FVAYARQY
Template Known Secondary structure 

GGGTT

.........................
Template Predicted Secondary structure 










.........................
Template SS confidence 


























































   218.220.........230.........240... ......250.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions