Return to main results Retrieve Phyre Job Id

Job DescriptionP77698
Confidence22.09%DateThu Jan 5 12:31:47 GMT 2012
Rank166Aligned Residues32
% Identity25%Templated1xsva_
SCOP infoDNA/RNA-binding 3-helical bundle Sigma3 and sigma4 domains of RNA polymerase sigma factors YlxM/p13-like
Resolution1.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   198.200..... ....210.........220.........230.........240..
Predicted Secondary structure  .

















Query SS confidence 







.




































Query Sequence  ELIFKLRM. ERRSLNAIAKYLNDHAVKNFSGKESAWGPSVIEKLLA
Query Conservation 
 

    . 
 
   

  

  

 
       
    
  

 
Alig confidence 







.












.............










Template Conservation 
 

 
 
   

  


  

.............

  

   
 
Template Sequence  RNYLELFYLEDYSLSEIADTFN. . . . . . . . . . . . . VSRQAVYDNIR
Template Known Secondary structure  TS


TT.............

Template Predicted Secondary structure 




.............

Template SS confidence 













































   28.30.........40......... 50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions