Return to main results Retrieve Phyre Job Id

Job DescriptionP77698
Confidence28.34%DateThu Jan 5 12:31:47 GMT 2012
Rank130Aligned Residues32
% Identity16%Templated1or7a1
SCOP infoDNA/RNA-binding 3-helical bundle Sigma3 and sigma4 domains of RNA polymerase sigma factors Sigma4 domain
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   198.200... ......210.........220.........230.........240..
Predicted Secondary structure  .

















Query SS confidence 





.






































Query Sequence  ELIFKL. RMERRSLNAIAKYLNDHAVKNFSGKESAWGPSVIEKLLA
Query Conservation 
 

  .   
 
   

  

  

 
       
    
  

 
Alig confidence 





.














.............










Template Conservation 
 
  
    
 
  


  

............. 
  

   
 
Template Sequence  RMAITLRELDGLSYEEIAAIMD. . . . . . . . . . . . . CPVGTVRSRIF
Template Known Secondary structure  TT


TT.............S
Template Predicted Secondary structure 




.............

Template SS confidence 













































   143......150.........160.... .....170.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions