Return to main results Retrieve Phyre Job Id

Job DescriptionP77698
Confidence36.54%DateThu Jan 5 12:31:47 GMT 2012
Rank91Aligned Residues35
% Identity17%Templatec3hugA_
PDB info PDB header:transcription/membrane proteinChain: A: PDB Molecule:rna polymerase sigma factor; PDBTitle: crystal structure of mycobacterium tuberculosis anti-sigma factor rsla2 in complex with -35 promoter binding domain of sigl
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   195....200... ......210.........220.........230.........240..
Predicted Secondary structure  .

















Query SS confidence 








.






































Query Sequence  KTIELIFKL. RMERRSLNAIAKYLNDHAVKNFSGKESAWGPSVIEKLLA
Query Conservation   


 

  .   
 
   

  

  

 
       
    
  

 
Alig confidence 








.














.............










Template Conservation     
 
  
      
  


  
 .............

  

   
 
Template Sequence  AEHRAVIQRSYYRGWSTAQIATDLG. . . . . . . . . . . . . IAEGTVKSRLH
Template Known Secondary structure  TS


T.............S
Template Predicted Secondary structure 



.............

Template SS confidence 
















































   125....130.........140......... 150.........160
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions