Return to main results Retrieve Phyre Job Id

Job DescriptionP77698
Confidence37.63%DateThu Jan 5 12:31:47 GMT 2012
Rank84Aligned Residues39
% Identity21%Templatec2w48D_
PDB info PDB header:transcriptionChain: D: PDB Molecule:sorbitol operon regulator; PDBTitle: crystal structure of the full-length sorbitol operon2 regulator sorc from klebsiella pneumoniae
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   191........200.........210.........220.........230.........240..
Predicted Secondary structure 

















Query SS confidence 



















































Query Sequence  PDRVKTIELIFKLRMERRSLNAIAKYLNDHAVKNFSGKESAWGPSVIEKLLA
Query Conservation   


 


 

     
 
   

  

  

 
       
    
  

 
Alig confidence 



























.............










Template Conservation      
   

 


  
 

 


  

.............


  




 
Template Sequence  DDIRLIVKIAQLYYEQDMTQAQIARELG. . . . . . . . . . . . . IYRTTISRLLK
Template Known Secondary structure  STS


T.............

S
Template Predicted Secondary structure 




.............

Template SS confidence 



















































   5....10.........20.........30.. .......40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions