Return to main results Retrieve Phyre Job Id

Job DescriptionP77698
Confidence47.03%DateThu Jan 5 12:31:47 GMT 2012
Rank54Aligned Residues26
% Identity19%Templatec2riqA_
PDB info PDB header:transferaseChain: A: PDB Molecule:poly [adp-ribose] polymerase 1; PDBTitle: crystal structure of the third zinc-binding domain of human parp-1
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   302.......310.........320.........330...
Predicted Secondary structure 

















Query SS confidence 































Query Sequence  LLRTVMKCEACGNTMIVHAVSGSLHGYYVCPM
Query Conservation 

 


 
  

  
           

 
  
Alig confidence 




















......




Template Conservation   



  

 
 
 
      ......
 
 
Template Sequence  VFGALLPCEECSGQLVFKSDA. . . . . . YYCTG
Template Known Secondary structure 



TTT


TT......

Template Predicted Secondary structure 













......

Template SS confidence 































   288.290.........300........ .310...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions