Return to main results Retrieve Phyre Job Id

Job DescriptionP77698
Confidence31.25%DateThu Jan 5 12:31:47 GMT 2012
Rank112Aligned Residues33
% Identity24%Templatec1x3uA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:transcriptional regulatory protein fixj; PDBTitle: solution structure of the c-terminal transcriptional2 activator domain of fixj from sinorhizobium melilot
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   198.200.........210.........220.........230.........240...
Predicted Secondary structure 


















Query SS confidence 













































Query Sequence  ELIFKLRMERRSLNAIAKYLNDHAVKNFSGKESAWGPSVIEKLLAN
Query Conservation 
 

     
 
   

  

  

 
       
    
  

 
Alig confidence 




















.............











Template Conservation    

 
   
 
  


  
 .............

  

      
Template Sequence  RQVLSAVVAGLPNKSIAYDLD. . . . . . . . . . . . . ISPRTVEVHRAN
Template Known Secondary structure  TTT

TT.............S
Template Predicted Secondary structure 



.............
Template SS confidence 













































   147..150.........160....... ..170.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions