Return to main results Retrieve Phyre Job Id

Job DescriptionP62554
Confidence9.20%DateThu Jan 5 12:07:36 GMT 2012
Rank18Aligned Residues32
% Identity9%Templatec3h93A_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:thiol:disulfide interchange protein dsba; PDBTitle: crystal structure of pseudomonas aeruginosa dsba
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51........60.........70.........80.........90.........
Predicted Secondary structure 












Query SS confidence 
















































Query Sequence  YPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFW
Query Conservation   
   
 
   

 
  




   

  




  

 

 


 
  
Alig confidence 








.










................











Template Conservation 








.  
        ................
     
  
  
Template Sequence  VPTXVVNGK. YRFDIGSAGGP. . . . . . . . . . . . . . . . EETLKLADYLIE
Template Known Secondary structure  SSTTT.TS................
Template Predicted Secondary structure 




.






................
Template SS confidence 
















































   153......160. ........170.. .......180....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions