Return to main results Retrieve Phyre Job Id

Job DescriptionP62554
Confidence6.15%DateThu Jan 5 12:07:36 GMT 2012
Rank31Aligned Residues31
% Identity13%Templatec3feuA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:putative lipoprotein; PDBTitle: crystal structure of dsba-like thioredoxin domain vf_a0457 from vibrio2 fischeri
Resolution1.76 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51........60.........70.........80.........90........
Predicted Secondary structure 












Query SS confidence 















































Query Sequence  YPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMF
Query Conservation   
   
 
   

 
  




   

  




  

 

 


 
 
Alig confidence 








.










................










Template Conservation 








.
 
        ................
 
   
  

Template Sequence  VPTFVVNGK. YNVLIGGHDDP. . . . . . . . . . . . . . . . KQIADTIRYLL
Template Known Secondary structure  SSTTT.
GGG
SS................
Template Predicted Secondary structure 



.






................
Template SS confidence 















































   150........ .160......... 170.........180
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions