Return to main results Retrieve Phyre Job Id

Job DescriptionP77488
Confidence24.00%DateThu Jan 5 12:29:48 GMT 2012
Rank117Aligned Residues30
% Identity23%Templatec2l6pA_
PDB info PDB header:structure genomics, unknown functionChain: A: PDB Molecule:phac1, phac2 and phad genes; PDBTitle: nmr solution structure of the protein np_253742.1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   73......80.. .......90. ........100..
Predicted Secondary structure 

....


......

Query SS confidence 









. . . .








. . . . . .










Query Sequence  QLIWDVGHQA. . . . YPHKILTGR. . . . . . RDKIGTIRQKG
Query Conservation 
 
 
 

  ....
    
 
 ......   
   
   
Alig confidence 









....








......










Template Conservation   
 




 





  

 
       
  

  
   
Template Sequence  KLSFDDGHDSGLFTWDYLYELATRKDQLWADYLAELASAG
Template Known Secondary structure  TTS





TTTTTT
Template Predicted Secondary structure 











Template SS confidence 







































   71........80.........90.........100.........110
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions