Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE37
Confidence90.33%DateThu Jan 5 11:22:26 GMT 2012
Rank130Aligned Residues48
% Identity23%Templatec3pp9B_
PDB info PDB header:transferaseChain: B: PDB Molecule:putative streptothricin acetyltransferase; PDBTitle: 1.6 angstrom resolution crystal structure of putative streptothricin2 acetyltransferase from bacillus anthracis str. ames in complex with3 acetyl coenzyme a
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90.........100.........110.........120.........130....
Predicted Secondary structure 

































Query SS confidence 















































































Query Sequence  EQGYVFVLEDSETGTVAGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSSELCTLFLDPDWRKE
Query Conservation     






  

 




 
 
  
   


 


 
  


  
 
      
 
  
 

 


 



 
  
  
Alig confidence 








..















....................................
















Template Conservation        
  ..    


         ....................................    
  
 
 
  

 
Template Sequence  PNQIIYIAL. . LHNQIIGFIVLKKNWN. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . NYAYIEDITVDKKYRTL
Template Known Secondary structure  SS..TT
TT....................................S

GGGTTS
Template Predicted Secondary structure 


..







....................................




Template SS confidence 















































































   71........ 80.........90..... ....100.........110..
 
   135....140
Predicted Secondary structure 

Query SS confidence 





Query Sequence  GNGYLL
Query Conservation    
 

Alig confidence 





Template Conservation 


  
Template Sequence  GVGKRL
Template Known Secondary structure  S
Template Predicted Secondary structure 
Template SS confidence 





   113.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions