Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE37
Confidence21.75%DateThu Jan 5 11:22:26 GMT 2012
Rank197Aligned Residues49
% Identity10%Templatec3dnsA_
PDB info PDB header:transferaseChain: A: PDB Molecule:ribosomal-protein-alanine acetyltransferase; PDBTitle: the n-terminal domain of ribosomal-protein-alanine acetyltransferase2 from clostridium acetobutylicum atcc 824
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   60.........70.........80.........90.........100.........110.........120.........130.........
Predicted Secondary structure 

































Query SS confidence 















































































Query Sequence  FVLEDSETGTVAGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSSELCTLFLDPDWRKEGNGYL
Query Conservation 




  

 




 
 
  
   


 


 
  


  
 
      
 
  
 

 


 



 
  
    
 
Alig confidence 




.








..................................






























Template Conservation 


  .  
  

 
.................................. 
  

  
   


  
      


   
Template Sequence  YLITD. KYGITIGRI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FIVDLNKDNRFCXFRXKIYKQGKSINTYIKE
Template Known Secondary structure  .TT

..................................TTTT


SS

Template Predicted Secondary structure  .



..................................














Template SS confidence 















































































   1920... ......30.. .......40.........50.........60...
 
   140...
Predicted Secondary structure 
Query SS confidence 



Query Sequence  LSKS
Query Conservation 


 
Alig confidence 



Template Conservation 
   
Template Sequence  ILSV
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 



   64...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions