Return to main results Retrieve Phyre Job Id

Job DescriptionP25888
Confidence87.91%DateThu Jan 5 11:42:41 GMT 2012
Rank287Aligned Residues33
% Identity21%Templated1qzxa3
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Nitrogenase iron protein-like
Resolution4.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   41........50.........60.........70.........80..
Predicted Secondary structure 














Query SS confidence 









































Query Sequence  LMASAQTGTGKTAGFTLPLLQHLITRQPHAKGRRPVRALILT
Query Conservation   

 








   



  
               


 
Alig confidence 












..













.......





Template Conservation 
 
 
  
 



..
   

  
     ....... 
 
  
Template Sequence  IMLVGVQGSGKTT. . TAGKLAYFYKKRGY. . . . . . . KVGLVA
Template Known Secondary structure 
SSSSSTTT..TT
.......
Template Predicted Secondary structure 





..





.......
Template SS confidence 









































   99100.........110. ........120..... ....130.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions