Return to main results Retrieve Phyre Job Id

Job DescriptionP25888
Confidence96.19%DateThu Jan 5 11:42:41 GMT 2012
Rank156Aligned Residues48
% Identity21%Templatec3jvvA_
PDB info PDB header:atp binding proteinChain: A: PDB Molecule:twitching mobility protein; PDBTitle: crystal structure of p. aeruginosa pilt with bound amp-pcp
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.......
Predicted Secondary structure 
























Query SS confidence 


































































Query Sequence  MSFDSLGLSPDILRAVAEQGYREPTPIQQQAIPAVLEGRDLMASAQTGTGKTAGFTLPLLQHLITRQ
Query Conservation    
  
 
   
   
   
   
  

  

  

 
   

 








   



  
    
Alig confidence 

















..................

















.











Template Conservation    
  


   
  
   ..................  




 
 







.
 


  
    
Template Sequence  LTMEELGMGEVFKRVSDV. . . . . . . . . . . . . . . . . . PRGLVLVTGPTGSGKSTT. LAAMLDYLNNTK
Template Known Secondary structure 

TTTTT


..................SS
STTS
.
Template Predicted Secondary structure 





..................







.




Template SS confidence 


































































   104.....110.........120. ........130......... 140.........150.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions