Return to main results Retrieve Phyre Job Id

Job DescriptionP25888
Confidence93.19%DateThu Jan 5 11:42:41 GMT 2012
Rank192Aligned Residues43
% Identity23%Templatec1sxjB_
PDB info PDB header:replicationChain: B: PDB Molecule:activator 1 37 kda subunit; PDBTitle: crystal structure of the eukaryotic clamp loader2 (replication factor c, rfc) bound to the dna sliding clamp3 (proliferating cell nuclear antigen, pcna)
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30......... 40.........50.........
Predicted Secondary structure 














..






Query SS confidence 





































. .



















Query Sequence  SFDSLGLSPDILRAVAEQGYREPTPIQQQAIPAVLEGR. . DLMASAQTGTGKTAGFTLPL
Query Conservation   
  
 
   
   
   
   
  

  

  

 
 ..  

 








   


Alig confidence 
















...............





..



















Template Conservation      
 
       
  ...............         


 

 
 





  

Template Sequence  VLSDIVGNKETIDRLQQ. . . . . . . . . . . . . . . IAKDGNMPHMIISGMPGIGKTTSVHCLA
Template Known Secondary structure  SGGG

S
T...............S





STTSS
Template Predicted Secondary structure 



...............










Template SS confidence 



























































   1920.........30..... ....40.........50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions