Return to main results Retrieve Phyre Job Id

Job DescriptionP14176
Confidence2.91%DateThu Jan 5 11:33:56 GMT 2012
Rank63Aligned Residues27
% Identity19%Templated1dw0a_
SCOP infoCytochrome c Cytochrome c monodomain cytochrome c
Resolution1.82

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50.........60.........70.........80...
Predicted Secondary structure 




















Query SS confidence 








































Query Sequence  TPAPNVEHFNILDPFHKTLIPLDSWVTEGIDWVVTHFRPVF
Query Conservation                      

         
        
Alig confidence 









..............
















Template Conservation 





 


..............
  





 


  
 
Template Sequence  APSATPDRFT. . . . . . . . . . . . . . DSARVEKWLGRNCNSVI
Template Known Secondary structure  STTTSTTTT
..............
Template Predicted Secondary structure 





..............

Template SS confidence 








































   67..70...... ...80.........90...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions