Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7G6
Confidence96.50%DateThu Jan 5 11:05:38 GMT 2012
Rank268Aligned Residues61
% Identity21%Templatec3pfiB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:holliday junction atp-dependent dna helicase ruvb; PDBTitle: 2.7 angstrom resolution crystal structure of a probable holliday2 junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni3 nctc 11168 in complex with adenosine-5'-diphosphate
Resolution2.69 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   63......70.........80.........90.........100.........110.........120.........130.........140..
Predicted Secondary structure 

























Query SS confidence 















































































Query Sequence  VEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVI
Query Conservation 


 
  






 
         
  




 
 
    
   

 
   
 
      
  
  
   
      

Alig confidence 
























...........................



























Template Conservation 


 







 

  

      ...........................              
           

Template Sequence  ILFSGPAGLGKTTLANIISYEXSAN. . . . . . . . . . . . . . . . . . . . . . . . . . . IKTTAAPXIEKSGDLAAILTNLSEGDIL
Template Known Secondary structure  SSTTSSTT

...........................GGG

SST

TT
Template Predicted Secondary structure 









...........................





Template SS confidence 















































































   55....60.........70......... 80.........90.........100.......
 
   143......150
Predicted Secondary structure 



Query SS confidence 







Query Sequence  VVDSVAAL
Query Conservation 




 

Alig confidence 







Template Conservation   



  
Template Sequence  FIDEIHRL
Template Known Secondary structure  SGGG
Template Predicted Secondary structure 

Template SS confidence 







   108.110.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions