Return to main results Retrieve Phyre Job Id

Job DescriptionP39343
Confidence90.63%DateThu Jan 5 11:59:33 GMT 2012
Rank337Aligned Residues31
% Identity23%Templatec3bddD_
PDB info PDB header:transcriptionChain: D: PDB Molecule:regulatory protein marr; PDBTitle: crystal structure of a putative multiple antibiotic-resistance2 repressor (ssu05_1136) from streptococcus suis 89/1591 at 2.20 a3 resolution
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50
Predicted Secondary structure 















Query SS confidence 













































Query Sequence  RISLQDIATLAGVTKMTVSRYIRSPKKVAKETGERIAKIMEEINYI
Query Conservation    

 


  



  






    
   

 

   
  


 
Alig confidence 





















...............








Template Conservation    
  


        


  
...............  

  


Template Sequence  PLHQLALQERLQIDRAAVTRHL. . . . . . . . . . . . . . . KLLEESGYI
Template Known Secondary structure  ST

...............TTS
Template Predicted Secondary structure 





...............
Template SS confidence 













































   44.....50.........60..... ....70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions