Return to main results Retrieve Phyre Job Id

Job DescriptionP39343
Confidence91.01%DateThu Jan 5 11:59:33 GMT 2012
Rank315Aligned Residues34
% Identity21%Templatec2o0yB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:transcriptional regulator; PDBTitle: crystal structure of putative transcriptional regulator rha1_ro069532 (iclr-family) from rhodococcus sp.
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50
Predicted Secondary structure 


















Query SS confidence 
















































Query Sequence  RNHRISLQDIATLAGVTKMTVSRYIRSPKKVAKETGERIAKIMEEINYI
Query Conservation    
  

 


  



  






    
   

 

   
  


 
Alig confidence 
























...............








Template Conservation       
  


  


  

  


............... 

   
 
Template Sequence  AHPTRSLKELVEGTKLPKTTVVRLV. . . . . . . . . . . . . . . ATXCARSVL
Template Known Secondary structure  TBST

...............TTS
Template Predicted Secondary structure 








...............


Template SS confidence 
















































   35....40.........50......... 60........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions