Return to main results Retrieve Phyre Job Id

Job DescriptionP62556
Confidence92.41%DateThu Jan 5 12:07:37 GMT 2012
Rank293Aligned Residues44
% Identity25%Templatec2fnaA_
PDB info PDB header:atp-binding proteinChain: A: PDB Molecule:conserved hypothetical protein; PDBTitle: crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus2 solfataricus p2 at 2.00 a resolution
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   85....90.........100.........110.........120.........130.........140...
Predicted Secondary structure 


















Query SS confidence 


























































Query Sequence  EQINHMRDVFGTRLRRAEDVFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEG
Query Conservation 
    

                

 
 
 







 
 


  

  
 





 
Alig confidence 









...........







.
















...








Template Conservation   

  
    ...........   
 
 
.  
 





       ...         
Template Sequence  KEIEKLKGLR. . . . . . . . . . . APITLVLG. LRRTGKSSIIKIGINEL. . . NLPYIYLDL
Template Known Secondary structure  T
...........SS.STTSS...T

G
Template Predicted Secondary structure  ...........


.





...


Template SS confidence 


























































   1920........ .30...... ...40.........50... ......60..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions