Return to main results Retrieve Phyre Job Id

Job DescriptionP77559
Confidence84.49%DateThu Jan 5 12:30:33 GMT 2012
Rank203Aligned Residues24
% Identity29%Templatec1zvvA_
PDB info PDB header:transcription/dnaChain: A: PDB Molecule:glucose-resistance amylase regulator; PDBTitle: crystal structure of a ccpa-crh-dna complex
Resolution2.98 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........
Predicted Secondary structure 








Query SS confidence 






































Query Sequence  MNIELRHLRYFVAVAEELHFGRAAARLNISQPPLSQQIQ
Query Conservation 
 
 
  
  
  
   

 
 

  
 


 


  
 
Alig confidence 







...............















Template Conservation 
 


 

...............
   


  






Template Sequence  MNVTIYDV. . . . . . . . . . . . . . . AREASVSMATVSRVVN
Template Known Secondary structure 

S
S...............TTS
Template Predicted Secondary structure 



...............



Template SS confidence 






































   1....... .10.........20....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions