Return to main results Retrieve Phyre Job Id

Job DescriptionP77237
Confidence22.74%DateThu Jan 5 12:26:41 GMT 2012
Rank3Aligned Residues22
% Identity32%Templatec2qjxA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:protein bim1; PDBTitle: structural basis of microtubule plus end tracking by2 xmap215, clip-170 and eb1
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30....
Predicted Secondary structure 


Query SS confidence 
































Query Sequence  KSMDKLTTGVAYGTSAGNAGFWALQLLDKVTPS
Query Conservation 
  

 

 







     
   

  

 
Alig confidence 












...........








Template Conservation   




 





...........

 
 
 
 
Template Sequence  KKIEECGTGAAYC. . . . . . . . . . . QIXDSIYGD
Template Known Secondary structure 
SGGGGGGS...........

Template Predicted Secondary structure 




...........


Template SS confidence 
































   25....30....... ..40......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions