Return to main results Retrieve Phyre Job Id

Job DescriptionP77237
Confidence17.68%DateThu Jan 5 12:26:41 GMT 2012
Rank7Aligned Residues22
% Identity32%Templatec1wyoA_
PDB info PDB header:structural proteinChain: A: PDB Molecule:microtubule-associated protein rp/eb family PDBTitle: solution structure of the ch domain of human microtubule-2 associated protein rp/eb family member 3
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30....
Predicted Secondary structure 


Query SS confidence 
































Query Sequence  KSMDKLTTGVAYGTSAGNAGFWALQLLDKVTPS
Query Conservation 
  

 

 







     
   

  

 
Alig confidence 












...........








Template Conservation   




 





...........

 
 
 

Template Sequence  TKIEQLCSGAAYC. . . . . . . . . . . QFMDMLFPG
Template Known Secondary structure  SSGGGGGG
...........STT
Template Predicted Secondary structure 




...........


Template SS confidence 
































   40.........50.. .......60.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions