Return to main results Retrieve Phyre Job Id

Job DescriptionP06983
Confidence31.16%DateWed Jan 25 15:20:12 GMT 2012
Rank66Aligned Residues55
% Identity15%Templatec3onmB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:transcriptional regulator lrha; PDBTitle: effector binding domain of lysr-type transcription factor rovm from y.2 pseudotuberculosis
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.........60.........70.........80.
Predicted Secondary structure 


























Query SS confidence 












































































Query Sequence  VLRIATRQSPLALWQAHYVKDKLMASHPGLVVELVPMVTRGDVILDTPLAKVGGKGLFVKELEVALLENRADIAVHS
Query Conservation   
 



 
 


 

  
   
    
    


 
 
 

      
   










 


 
 






Alig confidence 




















.





.








....................


















Template Conservation 




         

  
  .
    
.
 
 
    ....................             
     
Template Sequence  SLIIGASDDTADTLLPFLLNR. VATLYP. LAIDVRVKR. . . . . . . . . . . . . . . . . . . . SPFIADMLSSGEVDLAITT
Template Known Secondary structure 

TTT.TTS

.



....................GGGTTS
SS
Template Predicted Secondary structure 
.

.
....................
















Template SS confidence 












































































   100.........110.........120 ...... ...130..... ....140.........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions