Return to main results Retrieve Phyre Job Id

Job DescriptionP37679
Confidence25.71%DateThu Jan 5 11:56:53 GMT 2012
Rank452Aligned Residues40
% Identity13%Templatec3ff4A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of uncharacterized protein chu_1412
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   95....100.........110.........120.........130.........140.........150
Predicted Secondary structure 















Query SS confidence 























































Query Sequence  EIMSKAIRLARDLGIRTIQLAGYDVYYEDHDEGTRQRFAEGLAWAVEQAAASQVML
Query Conservation        
  
  

   
    
                  
      
   

 
Alig confidence 


























................












Template Conservation        
 
    
 
 
    
   
................

     
 

 
Template Sequence  QNQLSEYNYILSLKPKRVIFNPGTENE. . . . . . . . . . . . . . . . ELEEILSENGIEP
Template Known Secondary structure  GGG

S
TT


................TT
Template Predicted Secondary structure 









................


Template SS confidence 























































   66...70.........80.........90.. .......100.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions