Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF40
Confidence4.12%DateThu Jan 5 11:25:04 GMT 2012
Rank47Aligned Residues36
% Identity17%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   65....70.........80.........90.........100.........110....
Predicted Secondary structure 





Query SS confidence 

















































Query Sequence  GLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVIMVFWIGAKMRNRK
Query Conservation    
  




 




 

 










    


  

  
   

Alig confidence 














..............




















Template Conservation 





 







..............     
          




Template Sequence  IFMPLTFIAGIYGYP. . . . . . . . . . . . . . VVLAVMGVIAVIMVVYFKKKK
Template Known Secondary structure  TTS


..............TTTTS

Template Predicted Secondary structure  ..............

Template SS confidence 

















































   300.........310.... .....320.........330.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions