Return to main results Retrieve Phyre Job Id

Job DescriptionP37024
Confidence95.87%DateThu Jan 5 11:54:32 GMT 2012
Rank256Aligned Residues31
% Identity29%Templated1ofha_
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Extended AAA-ATPase domain
Resolution2.5

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20 .........30.......
Predicted Secondary structure 
................







Query SS confidence 













. . . . . . . . . . . . . . . .
















Query Sequence  AAVLPELLTALDCA. . . . . . . . . . . . . . . . PQVLLSAPTGAGKSTWL
Query Conservation        
  

   ................  


 








 
Alig confidence 













................
















Template Conservation    
   
   
                     


 







 

Template Sequence  ADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIA
Template Known Secondary structure  TTSS







TTSS
Template Predicted Secondary structure 















Template SS confidence 














































   21........30.........40.........50.........60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions