Return to main results Retrieve Phyre Job Id

Job DescriptionP37024
Confidence95.13%DateThu Jan 5 11:54:32 GMT 2012
Rank289Aligned Residues31
% Identity26%Templated1e94e_
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Extended AAA-ATPase domain
Resolution2.8

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20 .........30.......
Predicted Secondary structure 
................







Query SS confidence 













. . . . . . . . . . . . . . . .
















Query Sequence  AAVLPELLTALDCA. . . . . . . . . . . . . . . . PQVLLSAPTGAGKSTWL
Query Conservation        
  

   ................  


 








 
Alig confidence 













................
















Template Conservation 
 
   

 

  
  
            
 



 







 

Template Sequence  DNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIA
Template Known Secondary structure  TS







TTSS
Template Predicted Secondary structure 


















Template SS confidence 














































   21........30.........40.........50.........60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions