Return to main results Retrieve Phyre Job Id

Job DescriptionP37024
Confidence94.02%DateThu Jan 5 11:54:32 GMT 2012
Rank337Aligned Residues31
% Identity23%Templatec3h4mC_
PDB info PDB header:hydrolaseChain: C: PDB Molecule:proteasome-activating nucleotidase; PDBTitle: aaa atpase domain of the proteasome- activating nucleotidase
Resolution3.11 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10......... 20.........30.......
Predicted Secondary structure  ...............








Query SS confidence 












. . . . . . . . . . . . . . .

















Query Sequence  AAVLPELLTALDC. . . . . . . . . . . . . . . APQVLLSAPTGAGKSTWL
Query Conservation        
  

  ...............   


 








 
Alig confidence 












...............

















Template Conservation        
   
   
                


 







 

Template Sequence  EKQMQEIREVVELPLKHPELFEKVGIEPPKGILLYGPPGTGKTLLA
Template Known Secondary structure  TTTT
T



SSSSSSS
Template Predicted Secondary structure 













Template SS confidence 













































   176...180.........190.........200.........210.........220.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions