Return to main results Retrieve Phyre Job Id

Job DescriptionP37024
Confidence92.10%DateThu Jan 5 11:54:32 GMT 2012
Rank442Aligned Residues32
% Identity31%Templatec1iy2A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:atp-dependent metalloprotease ftsh; PDBTitle: crystal structure of the ftsh atpase domain from thermus2 thermophilus
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10......... 20.........30.......
Predicted Secondary structure  ...........








Query SS confidence 













. . . . . . . . . . .

















Query Sequence  VAAVLPELLTALDC. . . . . . . . . . . APQVLLSAPTGAGKSTWL
Query Conservation 
      
  

  ...........   


 








 
Alig confidence 













...........

















Template Conservation   
  
   
            
      


 







 

Template Sequence  AKEELKEIVEFLKNPSRFHEMGARIPKGVLLVGPPGVGKTHLA
Template Known Secondary structure 
TT






TTSS
Template Predicted Secondary structure 














Template SS confidence 










































   164.....170.........180.........190.........200......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions