Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADP9
Confidence3.09%DateThu Jan 5 11:21:31 GMT 2012
Rank41Aligned Residues31
% Identity26%Templated1bm9a_
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain Replication terminator protein (RTP)
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   48.50.........60.........70.........80.......
Predicted Secondary structure 










Query SS confidence 







































Query Sequence  DILIYHLKMRDSAKDAVIPGLQKDYEEDFKTALLRARGVI
Query Conservation 









   
 
 



 

 












 
Alig confidence 









.........




















Template Conservation 




 


 ......... 

 




 
 




  

Template Sequence  EVVLYQFKDY. . . . . . . . . EAAKLYKKQLKVELDRCKKLI
Template Known Secondary structure  S
.........
Template Predicted Secondary structure 


.........
Template SS confidence 







































   84.....90... ......100.........110....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions