Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADP9
Confidence7.89%DateThu Jan 5 11:21:31 GMT 2012
Rank14Aligned Residues29
% Identity31%Templated1bl0a2
SCOP infoDNA/RNA-binding 3-helical bundle Homeodomain-like AraC type transcriptional activator
Resolution2.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.
Predicted Secondary structure 








Query SS confidence 





































Query Sequence  KRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGE
Query Conservation 













 
  



 
 
 


 






Alig confidence 










.....







....









Template Conservation 


  
  

 ..... 
  

  ....

   

   
Template Sequence  RKMTEIAQKLK. . . . . ESNEPILY. . . . LAERYGFESQ
Template Known Secondary structure 
.....



....TT
S
Template Predicted Secondary structure 
.....




....


Template SS confidence 





































   63......70... ......80. ........90.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions