Return to main results Retrieve Phyre Job Id

Job DescriptionP31572
Confidence44.46%DateThu Jan 5 11:48:19 GMT 2012
Rank212Aligned Residues45
% Identity18%Templatec2g4rB_
PDB info PDB header:biosynthetic proteinChain: B: PDB Molecule:molybdopterin biosynthesis mog protein; PDBTitle: anomalous substructure of moga
Resolution1.92 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60.........70.........80.........90.....
Predicted Secondary structure 
























Query SS confidence 





































































Query Sequence  GPFAGQMFAEWGAEVIWIENVAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEA
Query Conservation 

 

  


 







 
  

  
         



 

 


    

  
  

  






Alig confidence 



















.........................
























Template Conservation 
  
   
   
  
     .........................
 

   
           





Template Sequence  GPIIAGWLEQHGFSSVQPQV. . . . . . . . . . . . . . . . . . . . . . . . . VADGNPVGEALHDAVNAGVDVIITS
Template Known Secondary structure  TT




.........................
SST
S
Template Predicted Secondary structure 


.........................






Template SS confidence 





































































   25....30.........40.... .....50.........60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions