Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9K3
Confidence96.59%DateThu Jan 5 11:10:33 GMT 2012
Rank175Aligned Residues33
% Identity33%Templatec3hteC_
PDB info PDB header:motor proteinChain: C: PDB Molecule:atp-dependent clp protease atp-binding subunit clpx; PDBTitle: crystal structure of nucleotide-free hexameric clpx
Resolution4.03 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   124.....130.. .......140.........150......
Predicted Secondary structure  ............









Query SS confidence 








. . . . . . . . . . . .























Query Sequence  NQAQYIANI. . . . . . . . . . . . LDHDITFGVGPAGTGKTYLAVAAA
Query Conservation   
   
 

............    

   







 

 
 
Alig confidence 








............























Template Conservation 

      
  

             


 







 

  

Template Sequence  GQEQAKKVLAVAVYNHYKRLRNGKSNILLIGPTGSGKTLLAETLA
Template Known Secondary structure  S






TTSS
Template Predicted Secondary structure 














Template SS confidence 












































   80.........90.........100.........110.........120....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions