Return to main results Retrieve Phyre Job Id

Job DescriptionC0Z3Y0
Confidence3.26%DateWed Jan 25 15:20:04 GMT 2012
Rank62Aligned Residues30
% Identity13%Templatec1yw5A_
PDB info PDB header:isomeraseChain: A: PDB Molecule:peptidyl prolyl cis/trans isomerase; PDBTitle: peptidyl-prolyl isomerase ess1 from candida albicans
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   62.......70.........80.........90.........100....
Predicted Secondary structure 








Query SS confidence 










































Query Sequence  SLKDARQITADLRKLYFSGTDPRTYFEEKVENSMTVAQCLDYW
Query Conservation 

  

  
         
 

   
        
       
Alig confidence 


















.............










Template Conservation 
   
      
   
   .............   
  

   
Template Sequence  TRDESIQILKKHLERILSG. . . . . . . . . . . . . EVKLSELANTE
Template Known Secondary structure 
T.............SS
Template Predicted Secondary structure 

.............


Template SS confidence 










































   95....100.........110... ......120....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions