Return to main results Retrieve Phyre Job Id

Job DescriptionP64564
Confidence4.15%DateThu Jan 5 12:09:29 GMT 2012
Rank13Aligned Residues29
% Identity21%Templated1brwa2
SCOP infoNucleoside phosphorylase/phosphoribosyltransferase catalytic domain Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   118 .120.........130.........140.........150.......
Predicted Secondary structure  .













Query SS confidence 
.






































Query Sequence  W. VSQGRSPIEYVLIQLADPLLRPIRRLLPAMGGIDFSPMI
Query Conservation 
.
     
    
  



 
 
 




 




 



Alig confidence 
.










........













...


Template Conservation 
 


  




 ........
  

  






...

 
Template Sequence  IGQTGDLTPADKK. . . . . . . . LYALRDVTATVNSI. . . PLI
Template Known Secondary structure 

TTS
........T



...
Template Predicted Secondary structure 





........





...
Template SS confidence 








































   151........160... ......170....... ..180
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions