Return to main results Retrieve Phyre Job Id

Job DescriptionP64564
Confidence7.23%DateThu Jan 5 12:09:29 GMT 2012
Rank3Aligned Residues29
% Identity17%Templatec3rruA_
PDB info PDB header:signaling proteinChain: A: PDB Molecule:tom1l1 protein; PDBTitle: x-ray crystal structure of the vhs domain of human tom1-like protein,2 northeast structural genomics consortium target hr3050e
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31.. ......40.........50.........60.........
Predicted Secondary structure 


.








Query SS confidence 


.



































Query Sequence  DFY. NPFSQFVVKVTQPIIGPLRRVIPAMGPIDSASLLVA
Query Conservation 
  .


 


 
 
 
 
 






  
 

 
 

  
Alig confidence 


.











..........













Template Conservation   
 

  
  




 ..........      

  
  
Template Sequence  DPYATSVGHLIEKATF. . . . . . . . . . AGVQTEDWGQFXHI
Template Known Secondary structure 
GGGST
..........SS

S

Template Predicted Secondary structure 





..........






Template SS confidence 







































   910.........20.... .....30........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions