Return to main results Retrieve Phyre Job Id

Job DescriptionP08339
Confidence34.18%DateThu Jan 5 11:01:11 GMT 2012
Rank6Aligned Residues41
% Identity27%Templatec3eatX_
PDB info PDB header:oxidoreductaseChain: X: PDB Molecule:pyoverdine biosynthesis protein pvcb; PDBTitle: crystal structure of the pvcb (pa2255) protein from2 pseudomonas aeruginosa
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40.........50.........60.........70.......
Predicted Secondary structure 


























Query SS confidence 






















































Query Sequence  VVDKRTSMHSRTASESTGARIHRPWCARHQVRPAWRCQYDKLHRVPFRSPELRLD
Query Conservation 






















































Alig confidence 





















............






..











Template Conservation 
 

  




  
     
 
............ 

 
  ..  
         
Template Sequence  IADNLTLLHGREAFAHRAPRHL. . . . . . . . . . . . RRVHIHA. . EPALRNPHLQRD
Template Known Secondary structure  TTT

BSS


..............
TTB


Template Predicted Secondary structure 










............
..











Template SS confidence 






















































   251........260.........270.. ....... 280.........290.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions