Return to main results Retrieve Phyre Job Id

Job DescriptionP07862
Confidence79.22%DateThu Jan 5 11:00:37 GMT 2012
Rank441Aligned Residues32
% Identity22%Templatec3nlcA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein vp0956; PDBTitle: crystal structure of the vp0956 protein from vibrio parahaemolyticus.2 northeast structural genomics consortium target vpr147
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.
Predicted Secondary structure 










Query SS confidence 








































Query Sequence  MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVD
Query Conservation 
  

 
  

   
  
 
 
   
  

   
  
  

Alig confidence 












.........


















Template Conservation       





 
.........

 

  

  
  
 


Template Sequence  LTERPIVIGFGPC. . . . . . . . . GLFAGLVLAQXGFNPIIVE
Template Known Secondary structure 






S.........TT



Template Predicted Secondary structure 






.........



Template SS confidence 








































   96...100........ .110.........120.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions