Return to main results Retrieve Phyre Job Id

Job DescriptionP00893
Confidence60.00%DateThu Jan 5 10:57:03 GMT 2012
Rank167Aligned Residues52
% Identity23%Templatec3nbmA_
PDB info PDB header:transferaseChain: A: PDB Molecule:pts system, lactose-specific iibc components; PDBTitle: the lactose-specific iib component domain structure of the2 phosphoenolpyruvate:carbohydrate phosphotransferase system (pts) from3 streptococcus pneumoniae.
Resolution1.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   208.210.........220.........230.........240.........250.........260.........270........
Predicted Secondary structure 




































Query SS confidence 






































































Query Sequence  KPVVYVGGGAITAGCHQQLKETVEALNLPVVCSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFA
Query Conservation 




 
 
         
  


 
  

              
   
  
          
  

 

 
Alig confidence 







































...................











Template Conservation 



 
  
 


 
  

   
        
 
      ...................       




Template Sequence  KVLVLCAGSGTSAQLANAINEGANLTEVRVIANSGAYGAH. . . . . . . . . . . . . . . . . . . YDIXGVYDLIIL
Template Known Secondary structure  SSSST
STTS
...................TTTGGG
S
Template Predicted Secondary structure 








...................




Template SS confidence 






































































   457..460.........470.........480.........490...... ...500........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions