Return to main results Retrieve Phyre Job Id

Job DescriptionP46121
Confidence2.87%DateThu Jan 5 12:04:00 GMT 2012
Rank8Aligned Residues28
% Identity36%Templatec3b0vD_
PDB info PDB header:oxidoreductase/rnaChain: D: PDB Molecule:trna-dihydrouridine synthase; PDBTitle: trna-dihydrouridine synthase from thermus thermophilus in complex with2 trna
Resolution3.51 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60........
Predicted Secondary structure 










Query SS confidence 




































Query Sequence  SQEDLYAEVPLVGRLTGIEEVKVEAIAMSKLHNMSCP
Query Conservation 











 























Alig confidence 






















.........




Template Conservation    
     

      
 
 


.........
 


Template Sequence  SDPKSLAEAARIGEAFGYDEINL. . . . . . . . . NLGCP
Template Known Secondary structure  S
TT
S.........


Template Predicted Secondary structure 





.........




Template SS confidence 




































   67..70.........80......... 90....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions